Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP169492

SRD5A2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP169492 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169492 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP169492 Supplier Novus Biologicals Supplier No. NBP169492
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SRD5A2 Polyclonal specifically detects SRD5A2 in Human, Monkey samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen SRD5A2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q28892
Gene Alias 3-oxo-5-alpha-steroid 4-dehydrogenase 2,5 alpha-SR2, EC 1.3.99.5, MGC138457, S5AR 2, SR type 2, Steroid 5-alpha-reductase 2,3-oxo-5 alpha-steroid 4-dehydrogenase 2, steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta4-dehydrogenase alpha 2), Type II 5-alpha reductase
Gene Symbols SRD5A2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SRD5A2(steroid-5-alpha-reductase, alpha polypeptide 2) The peptide sequence was selected from the N terminal of SRD5A2. Peptide sequence MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR.
Molecular Weight of Antigen 28 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 6716
Test Specificity Porcine: 86%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Pig, Monkey, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.