Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SREBP1 Antibody, Novus Biologicals™

SREBP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP276535 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP276535 100 μL
NB392745 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP276535 Supplier Novus Biologicals Supplier No. NBP276535
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SREBP1 Polyclonal specifically detects SREBP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen SREBP1
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1 - 4 μ/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias BHLHD1, Class D basic helix-loop-helix protein 1, SREBP 1c, SREBP-1, SREBP1bHLHd1SREBP-1c, sterol regulatory element binding protein-1, sterol regulatory element binding transcription factor 1, sterol regulatory element-binding protein 1, Sterol regulatory element-binding transcription factor 1
Gene Symbols SREBF1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: WESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSM
Quantity 100 μL
Primary or Secondary Primary
Gene ID (Entrez) 6720
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.