SREC-I/SCARF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257396

Catalog No. NBP257396

Description

SREC-I/SCARF1 Polyclonal specifically detects SREC-I/SCARF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SREC-I/SCARF1
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: Acetyl LDL receptor, KIAA0149endothelial cells scavenger receptor, MGC47738, scavenger receptor class F, member 1, Scavenger receptor expressed by endothelial cells 1, SREC1, SREC-I, SRECscavenger receptor expressed by endothelial cells
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SCARF1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPI
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 8578
• Target Species: Human
• Isotype: IgG

For Research Use Only