Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SREC-I/SCARF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | SREC-I/SCARF1 |
---|---|
Dilution | Immunohistochemistry-Paraffin 1:50 - 1:200 |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SREC-I/SCARF1 Polyclonal specifically detects SREC-I/SCARF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SREC-I/SCARF1 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
8578 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPI | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Unconjugated | |
RUO | |
Human | |
Acetyl LDL receptor, KIAA0149endothelial cells scavenger receptor, MGC47738, scavenger receptor class F, member 1, Scavenger receptor expressed by endothelial cells 1, SREC1, SREC-I, SRECscavenger receptor expressed by endothelial cells | |
SCARF1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title