Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SRP54 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157414 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157414 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157414 Supplier Novus Biologicals Supplier No. NBP157414
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SRP54 Polyclonal specifically detects SRP54 in Human samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

Antigen SRP54
Applications Western Blot, Immunoprecipitation
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunoprecipitation
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P61011
Gene Alias signal recognition particle 54 kDa protein, signal recognition particle 54kD, signal recognition particle 54kDa
Gene Symbols SRP54
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SRP54(signal recognition particle 54kDa) The peptide sequence was selected from the middle region of SRP54. Peptide sequence ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 6729
Test Specificity Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.