SRP54 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157414

Catalog No. NBP157414

Description

SRP54 Polyclonal specifically detects SRP54 in Human samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: SRP54
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: signal recognition particle 54 kDa protein, signal recognition particle 54kD, signal recognition particle 54kDa
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunoprecipitation
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunoprecipitation
• Gene Accession No.: P61011
• Gene Symbols: SRP54
• Immunogen: Synthetic peptides corresponding to SRP54(signal recognition particle 54kDa) The peptide sequence was selected from the middle region of SRP54. Peptide sequence ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 6729
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only