SRPRB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159710

Catalog No. NBP159710

Description

SRPRB Polyclonal specifically detects SRPRB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SRPRB
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: APMCF1, Protein APMCF1, signal recognition particle receptor subunit beta, signal recognition particle receptor, B subunit, signal recognition particle receptor, beta subunit, SR-beta
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: beta.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
• Gene Accession No.: Q9Y5M8
• Gene Symbols: SRPRB
• Immunogen: Synthetic peptides corresponding to SRPRB(signal recognition particle receptor, B subunit) The peptide sequence was selected from the middle region of SRPRB. Peptide sequence QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 58477
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.