Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SRPRB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	SRPRB
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP159710 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159710	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

SRPRB Polyclonal specifically detects SRPRB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	SRPRB
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	APMCF1, Protein APMCF1, signal recognition particle receptor subunit beta, signal recognition particle receptor, B subunit, signal recognition particle receptor, beta subunit, SR-beta
Gene Symbols	SRPRB
Isotype	IgG
Test Specificity	This product is specific to Subunit or Isoform: beta.

Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q9Y5M8
Gene ID (Entrez)	58477
Immunogen	Synthetic peptides corresponding to SRPRB(signal recognition particle receptor, B subunit) The peptide sequence was selected from the middle region of SRPRB. Peptide sequence QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE.
Primary or Secondary	Primary
Molecular Weight of Antigen	30 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SRPRB Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents