Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SSBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | SSBP2 |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
Applications | Western Blot, Immunohistochemistry |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
SSBP2 Polyclonal specifically detects SSBP2 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
SSBP2 | |
Western Blot, Immunohistochemistry | |
Unconjugated | |
Rabbit | |
Human | |
DKFZp686F03273, HSPC116, Sequence-specific single-stranded-DNA-binding protein 2, single-stranded DNA binding protein 2, single-stranded DNA-binding protein 2, SOSS-B2, SSDP2 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human SSBP2 (NP_036578). Peptide sequence YPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTP | |
Affinity purified |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
23635 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title