SSR3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18066725UL

Catalog No. NB407462

Description

SSR3 Polyclonal antibody specifically detects SSR3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: SSR3
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:500, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: signal sequence receptor, gamma (translocon-associated protein gamma), SSR gamma, SSR-gamma, translocon-associated protein gamma subunit, translocon-associated protein subunit gamma, TRAP-complex gamma subunit, TRAP-gamma, TRAPGSignal sequence receptor subunit gamma
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6747
• Target Species: Rat, Human, Mouse
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SSR3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEA
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only