Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SSR3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$416.50 - $682.00
Specifications
| Antigen | SSR3 |
|---|---|
| Dilution | Western Blot 1:100-1:500, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SSR3 Polyclonal antibody specifically detects SSR3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
| SSR3 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6747 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 1:100-1:500, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Rat, Human, Mouse | |
| signal sequence receptor, gamma (translocon-associated protein gamma), SSR gamma, SSR-gamma, translocon-associated protein gamma subunit, translocon-associated protein subunit gamma, TRAP-complex gamma subunit, TRAP-gamma, TRAPGSignal sequence receptor subunit gamma | |
| SSR3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title