Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SSTK-IP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00

Specifications

Antigen	SSTK-IP
Dilution	Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL
Applications	Western Blot, Immunocytochemistry
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB397309 View Documents View Product Certificates	Novus Biologicals NBP23392325UL	25 μL	Each of 1 for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SSTK-IP Polyclonal antibody specifically detects SSTK-IP in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

Antigen	SSTK-IP
Applications	Western Blot, Immunocytochemistry
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene Accession No.	Q96A04
Gene ID (Entrez)	128229
Isotype	IgG
Purification Method	Immunogen affinity purified

Dilution	Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol
Gene Alias	C1orf182, chromosome 1 open reading frame 182, MGC26877, RP11-443G18.5, SIP, SSTK-interacting protein (SSTK-IP), SSTK-IP
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLG
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SSTK-IP Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents