ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162540

Catalog No. NBP162540

Description

ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Polyclonal specifically detects ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Alpha 2,3-ST 1, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1, DKFZp666E036, DKFZp779K2051, EC 2.4.99, EC 2.4.99.4, Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase, Gal-NAc6S, Sialyltransferase 4A, sialyltransferase 4A (beta-galactosidase alpha-2,3-sialytransferase), sialyltransferase 4A (beta-galactoside alpha-2,3-sialyltransferase), sialyltransferase 4A (beta-galactoside alpha-2,3-sialytransferase), SIAT4, SIAT4A, SIAT4-A, SIATFLFLJ36548, ST3 beta-galactoside alpha-2,3-sialyltransferase 1, ST3Gal I, ST3GalA.1MGC9183, ST3GalI, ST3GalIA, ST3GalIA1,Beta-galactoside alpha-2,3-sialyltransferase 1, ST3OST3GalA
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q11201
• Gene Symbols: ST3GAL1
• Immunogen: Synthetic peptides corresponding to ST3GAL1(ST3 beta-galactoside alpha-2,3-sialyltransferase 1) The peptide sequence was selected from the C terminal of ST3GAL1. Peptide sequence YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6482
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only