Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP162540
Description
ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Polyclonal specifically detects ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A in Human samples. It is validated for Western Blot.Specifications
ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Alpha 2,3-ST 1, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1, DKFZp666E036, DKFZp779K2051, EC 2.4.99, EC 2.4.99.4, Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase, Gal-NAc6S, Sialyltransferase 4A, sialyltransferase 4A (beta-galactosidase alpha-2,3-sialytransferase), sialyltransferase 4A (beta-galactoside alpha-2,3-sialyltransferase), sialyltransferase 4A (beta-galactoside alpha-2,3-sialytransferase), SIAT4, SIAT4A, SIAT4-A, SIATFLFLJ36548, ST3 beta-galactoside alpha-2,3-sialyltransferase 1, ST3Gal I, ST3GalA.1MGC9183, ST3GalI, ST3GalIA, ST3GalIA1,Beta-galactoside alpha-2,3-sialyltransferase 1, ST3OST3GalA | |
Rabbit | |
39 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q11201 | |
ST3GAL1 | |
Synthetic peptides corresponding to ST3GAL1(ST3 beta-galactoside alpha-2,3-sialyltransferase 1) The peptide sequence was selected from the C terminal of ST3GAL1. Peptide sequence YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN. | |
Affinity purified | |
RUO | |
6482 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction