Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169570
Description
ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Polyclonal specifically detects ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 in Human samples. It is validated for Western Blot.Specifications
ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Alpha 2,3-ST 2, Beta-galactoside alpha-2,3-sialyltransferase 2, beta-galactoside alpha-2,3-sialytransferase, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2, EC 2.4.99.4, EC 2.4.99.7, Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase, Gal-NAc6S, Sialyltransferase 4B, sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase), SIAT4B, SIAT4-B, ST3 beta-galactoside alpha-2,3-sialyltransferase 2, ST3GalA.2ST3Gal II, ST3GALII | |
Rabbit | |
40 kDa | |
100 μL | |
Primary | |
Zebrafish: 86%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q16842 | |
ST3GAL2 | |
Synthetic peptides corresponding to ST3GAL2(ST3 beta-galactoside alpha-2,3-sialyltransferase 2) The peptide sequence was selected from the C terminal of ST3GAL2. Peptide sequence ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN. | |
Affinity purified | |
RUO | |
6483 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction