ST3GAL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162554

Catalog No. NBP162554

Description

ST3GAL3 Polyclonal specifically detects ST3GAL3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ST3GAL3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: alpha 2,3-sialyltransferase III, Alpha 2,3-ST 3, alpha-2,3-sialyltransferase II, Beta-galactoside alpha-2,3-sialyltransferase 3, CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase, EC 2.4.99.6, Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase, Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase, N-acetyllactosaminide alpha-2,3-sialyltransferase, Sialyltransferase 6, SIAT6sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase), ST3 beta-galactoside alpha-2,3-sialyltransferase 3, ST3Gal III, ST3GALII, ST3GalIII, ST3N
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q11203
• Gene Symbols: ST3GAL3
• Immunogen: Synthetic peptides corresponding to ST3GAL3(ST3 beta-galactoside alpha-2,3-sialyltransferase 3) The peptide sequence was selected from the N terminal of ST3GAL3. Peptide sequence MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6487
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
• Isotype: IgG