Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ST3GAL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$480.74

Specifications

Antigen	ST3GAL3
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP162554 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP162554	100 μL	Each of 1 for $480.74	Only null left	Sign In or Register to check your price. Add to Cart

Description

ST3GAL3 Polyclonal specifically detects ST3GAL3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ST3GAL3
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q11203
Gene ID (Entrez)	6487
Immunogen	Synthetic peptides corresponding to ST3GAL3(ST3 beta-galactoside alpha-2,3-sialyltransferase 3) The peptide sequence was selected from the N terminal of ST3GAL3. Peptide sequence MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	alpha 2,3-sialyltransferase III, Alpha 2,3-ST 3, alpha-2,3-sialyltransferase II, Beta-galactoside alpha-2,3-sialyltransferase 3, CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase, EC 2.4.99.6, Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase, Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase, N-acetyllactosaminide alpha-2,3-sialyltransferase, Sialyltransferase 6, SIAT6sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase), ST3 beta-galactoside alpha-2,3-sialyltransferase 3, ST3Gal III, ST3GALII, ST3GalIII, ST3N
Gene Symbols	ST3GAL3
Isotype	IgG
Molecular Weight of Antigen	42 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ST3GAL3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents