ST3GAL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25652225UL

Catalog No. NB394441

Description

ST3GAL5 Polyclonal specifically detects ST3GAL5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ST3GAL5
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: alpha 2,3-sialyltransferase V, CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase, EC 2.4.99.9, Ganglioside GM3 synthase, GM3 synthase, lactosylceramide alpha-2,3-sialyltransferase, Sialyltransferase 9, sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase;GM3 synthase), SIATGM3S, ST3 beta-galactoside alpha-2,3-sialyltransferase 5, ST3Gal V, ST3GALV, ST3GalVSIAT9SATI
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ST3GAL5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWG
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 8869
• Target Species: Human
• Form: Purified

For Research Use Only