Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP162444

ST3GAL5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP162444 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP162444 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP162444 Supplier Novus Biologicals Supplier No. NBP162444
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ST3GAL5 Polyclonal specifically detects ST3GAL5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen ST3GAL5
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9UNP4
Gene Alias alpha 2,3-sialyltransferase V, CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase, EC 2.4.99.9, Ganglioside GM3 synthase, GM3 synthase, lactosylceramide alpha-2,3-sialyltransferase, Sialyltransferase 9, sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase;GM3 synthase), SIATGM3S, ST3 beta-galactoside alpha-2,3-sialyltransferase 5, ST3Gal V, ST3GALV, ST3GalVSIAT9SATI
Gene Symbols ST3GAL5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ST3GAL5(ST3 beta-galactoside alpha-2,3-sialyltransferase 5) The peptide sequence was selected from the N terminal of ST3GAL5 (NP_003887). Peptide sequence DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS.
Molecular Weight of Antigen 48 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 8869
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Goat, Rabbit, Sheep
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.