Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ST6 Sialyltransferase 6/ST6GALNAC6 Antibody, Novus Biologicals™

ST6 Sialyltransferase 6/ST6GALNAC6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15995920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15995920 20 μL
NBP159959 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15995920 Supplier Novus Biologicals Supplier No. NBP15995920UL

Description

Rabbit Polyclonal Antibody

ST6 Sialyltransferase 6/ST6GALNAC6 Polyclonal specifically detects ST6 Sialyltransferase 6/ST6GALNAC6 in Human samples. It is validated for Western Blot.

Specifications

Antigen ST6 Sialyltransferase 6/ST6GALNAC6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q969X2
Gene Alias alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.7, GalNAc alpha-2,6-sialyltransferase VI, hST6GalNAc VI, RP11-203J24.3, Sialyltransferase 7F, sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialytransferase) F, SIAT7F, SIAT7-F, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 6, ST6GalNAc VI, ST6GalNAcVI
Gene Symbols ST6GALNAC6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ST6GALNAC6(ST6 -N-acetylgalactosaminide alpha-2,6-sialyltransferase 6) The peptide sequence was selected from the C terminal of ST6GALNAC6. Peptide sequence YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGIT
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 30815
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.