Learn More
ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | Alpha-2,8-sialyltransferase 8D, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, EC 2.4.99, EC 2.4.99.-, Polysialyltransferase-1, PST1MGC61459, PSTMGC34450, sialyltransferase 8 (alpha-2, 8-polysialytransferase) D, Sialyltransferase 8D, Sialytransferase St8Sia IV, SIAT8D, SIAT8-D, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4, ST8SiaIV, ST8SIA-IV |
| Gene Symbols | ST8SIA4 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: RTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLD |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.