Learn More
ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | Alpha-2,8-sialyltransferase 8A, alpha-N-acetylneuraminide alpha-2,8-sialyltransferase, disialoganglioside (GD3) synthase, Ganglioside GD3 synthase, Ganglioside GT3 synthase, ganglioside-specific alpha-2,8-polysialyltransferase, GD3 synthase), GD3S, sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2,8-sialytransferase, GD3synthase) A, Sialyltransferase 8A, sialyltransferase 8A (alpha-N-acetylneuraminate: alpha-2,8-sialyltransferase, Sialytransferase St8Sia I, SIAT8A, SIAT8-A, SIAT8EC 2.4.99.8, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1, ST8SiaI |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 (NP_001291379.1). Peptide sequence GSFYTHSPLTIQLTLSSHRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQR |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.