Stabilin-2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP31709225UL

Catalog No. NB169261

Description

Stabilin-2 Polyclonal antibody specifically detects Stabilin-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Stabilin-2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: CD44-like precursor FELL, DKFZP434E0321, FAS1 EGF-like and X-link domain containing adhesion molecule-2, FAS1 EGF-like and X-link domain-containing adhesion molecule 2, fasciclin egf-like, laminin-type egf-like, and link domain-containing scavengerreceptor-2, Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavengerreceptor 2, FEEL2, FEEL-2, FELE-2, FELL, FEX2, HAREFELL2, hepatic hyaluronan clearance receptor, Hyaluronan receptor for endocytosis, hyaluronic acid receptor for endocytosis, STAB-2, stabilin 2, stabilin-2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KGYVGDGLTCYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNVNELLVDNKAAQYFVKLH
• Quantity: 25 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55576
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG