Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Stabilin-2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31709225UL
This item is not returnable.
View return policy
Description
Stabilin-2 Polyclonal antibody specifically detects Stabilin-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Stabilin-2 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| CD44-like precursor FELL, DKFZP434E0321, FAS1 EGF-like and X-link domain containing adhesion molecule-2, FAS1 EGF-like and X-link domain-containing adhesion molecule 2, fasciclin egf-like, laminin-type egf-like, and link domain-containing scavengerreceptor-2, Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavengerreceptor 2, FEEL2, FEEL-2, FELE-2, FELL, FEX2, HAREFELL2, hepatic hyaluronan clearance receptor, Hyaluronan receptor for endocytosis, hyaluronic acid receptor for endocytosis, STAB-2, stabilin 2, stabilin-2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KGYVGDGLTCYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNVNELLVDNKAAQYFVKLH | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 55576 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction