Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. STAG3 Antibody, Novus Biologicals™

STAG3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15808720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15808720 20 μL
NBP158087 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15808720 Supplier Novus Biologicals Supplier No. NBP15808720UL

Description

Rabbit Polyclonal Antibody

STAG3 Polyclonal specifically detects STAG3 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen STAG3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9UJ98
Gene Alias cohesin subunit SA-3, SCC3 homolog 3, stromal antigen 3stromalin 3, stromalin-3
Gene Symbols STAG3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to STAG3(stromal antigen 3) The peptide sequence was selected from the middle region of STAG3. Peptide sequence VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 10734
Test Specificity This product is specific to Subunit or Isoform: SA-3.
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.