STARD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168978

Catalog No. NBP168978

Description

STARD4 Polyclonal specifically detects STARD4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: STARD4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: StARD4, StAR-related lipid transfer (START) domain containing 4, stAR-related lipid transfer protein 4, START domain containing 4 sterol-regulated, START domain-containing protein 4, sterol regulated
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96DR4
• Gene Symbols: STARD4
• Immunogen: Synthetic peptides corresponding to STARD4 (StAR-related lipid transfer (START) domain containing 4) The peptide sequence was selected from the middle region of STARD4. Peptide sequence CCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 134429
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG