Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
STARD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | STARD4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
STARD4 Polyclonal specifically detects STARD4 in Human samples. It is validated for Western Blot.Specifications
STARD4 | |
Polyclonal | |
Rabbit | |
Q96DR4 | |
134429 | |
Synthetic peptides corresponding to STARD4 (StAR-related lipid transfer (START) domain containing 4) The peptide sequence was selected from the middle region of STARD4. Peptide sequence CCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
StARD4, StAR-related lipid transfer (START) domain containing 4, stAR-related lipid transfer protein 4, START domain containing 4 sterol-regulated, START domain-containing protein 4, sterol regulated | |
STARD4 | |
IgG | |
23 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title