STARD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169098

Catalog No. NBP169098

Description

STARD8 Polyclonal specifically detects STARD8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: STARD8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: STARD8
• Immunogen: Synthetic peptides corresponding to STARD8 (StAR-related lipid transfer (START) domain containing 8) The peptide sequence was selected from the N terminal of STARD8. Peptide sequence KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9754
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ARHGAP38, Deleted in liver cancer 3 protein, DKFZp686H1668, DLC3DLC-3, KIAA0189stAR-related lipid transfer protein 8, StARD8, StAR-related lipid transfer (START) domain containing 8, START domain containing 8, START domain-containing protein 8, STARTGAP3, START-GAP3
• Host Species: Rabbit
• Molecular Weight of Antigen: 122 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.