STEAP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP183100

Catalog No. NBP183100

Description

STEAP2 Polyclonal specifically detects STEAP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: STEAP2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 1.16.1, EC 1.16.1.-, IPCA1, metalloreductase STEAP2, PCANAP1STMP, prostate cancer associated protein 1, Prostate cancer-associated protein 1, Protein upregulated in metastatic prostate cancer, PUMPCn, six transmembrane epithelial antigen of prostate 2, six transmembrane epithelial antigen of the prostate 2, Six-transmembrane epithelial antigen of prostate 2, SixTransMembrane protein of prostate 1, STAMP1IPCA-1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 261729
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: STEAP2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EYLASLFPDSLIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only