STK16 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP156541	100 μL

Catalog No. NBP156541 Supplier Novus Biologicals Supplier No. NBP156541

Description

Rabbit Polyclonal Antibody

STK16 Polyclonal specifically detects STK16 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: STK16
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: O75716
• Gene Alias: EC 2.7.11.1, FLJ39635, hPSK, MGC16211, MPSK1, MPSKFLJ39635, Myristoylated and palmitoylated serine/threonine-protein kinase, PKL12KRCT, protein kinase expressed in day 12 fetal liver, Protein kinase PKL12, serine/threonine kinase 16, serine/threonine-protein kinase 16, TGF-beta-stimulated factor 1, TSF1, TSF-1
• Gene Symbols: STK16
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to STK16(serine/threonine kinase 16) The peptide sequence was selected from the middle region of STK16. Peptide sequence TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Gene ID (Entrez): 8576
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Goat: 100%; Human: 100%; Rabbit: 100%; Bovine: 92%; Mouse: 92%; Pig: 92%; Rat: 92%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only