Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
STK22C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24867425UL
Description
STK22C Polyclonal antibody specifically detects STK22C in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
STK22C | |
Polyclonal | |
Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
EC 2.7.11, EC 2.7.11.1, serine/threonine kinase 22C (spermiogenesis associated), Serine/threonine-protein kinase 22C, SPOGA3TSK3, STK22Cspermiogenesis associated 3, STK22D, Testis-specific kinase 3, testis-specific serine kinase 3, testis-specific serine/threonine kinase 22C, testis-specific serine/threonine-protein kinase 3, TSK-3, TSSK-3 | |
This antibody was developed against a recombinant protein corresponding to amino acids: QRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMV | |
25 μL | |
Protein Kinase | |
81629 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction