STK22C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24867425UL

Catalog No. NB396043

Description

STK22C Polyclonal antibody specifically detects STK22C in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: STK22C
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: EC 2.7.11, EC 2.7.11.1, serine/threonine kinase 22C (spermiogenesis associated), Serine/threonine-protein kinase 22C, SPOGA3TSK3, STK22Cspermiogenesis associated 3, STK22D, Testis-specific kinase 3, testis-specific serine kinase 3, testis-specific serine/threonine kinase 22C, testis-specific serine/threonine-protein kinase 3, TSK-3, TSSK-3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMV
• Quantity: 25 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 81629
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified