Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

STK22C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00

Specifications

Antigen	STK22C
Dilution	Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Applications	Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB396043 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP24867425UL	25 μL	Each of 1 for $382.00	Only null left	Sign In or Register to check your price. Add to Cart

Description

STK22C Polyclonal antibody specifically detects STK22C in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen	STK22C
Applications	Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Protein Kinase
Formulation	PBS (pH 7.2), 40% Glycerol
Gene ID (Entrez)	81629
Isotype	IgG
Purification Method	Immunogen affinity purified

Dilution	Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	EC 2.7.11, EC 2.7.11.1, serine/threonine kinase 22C (spermiogenesis associated), Serine/threonine-protein kinase 22C, SPOGA3TSK3, STK22Cspermiogenesis associated 3, STK22D, Testis-specific kinase 3, testis-specific serine kinase 3, testis-specific serine/threonine kinase 22C, testis-specific serine/threonine-protein kinase 3, TSK-3, TSSK-3
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: QRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMV
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

STK22C Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents