STK32A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18273525UL

Catalog No. NB407059

Description

STK32A Polyclonal specifically detects STK32A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: STK32A
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: A930015B13Rik, EC 2.7.11, EC 2.7.11.1, MGC22688, serine/threonine kinase 32A, YANK1serine/threonine-protein kinase 32A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: STK32A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDINWDAVFQKRLIPGFIP
• Quantity: 25 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 202374
• Target Species: Human
• Isotype: IgG

For Research Use Only