STK33 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25867425UL

Catalog No. NB393335

Description

STK33 Polyclonal specifically detects STK33 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: STK33
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: EC 2.7.11, EC 2.7.11.1, serine/threonine kinase 33, serine/threonine-protein kinase 33
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: STK33
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPVTPSQGTATKYPAKS
• Quantity: 25 μL
• Research Discipline: Cancer, Protein Kinase
• Gene ID (Entrez): 65975
• Target Species: Human
• Isotype: IgG

For Research Use Only