Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

STK38 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158362 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158362 100 μL
NBP15836220 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP158362 Supplier Novus Biologicals Supplier No. NBP158362
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

STK38 Polyclonal specifically detects STK38 in Human samples. It is validated for Western Blot.

Specifications

Antigen STK38
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q15208
Gene Alias EC 2.7.11, EC 2.7.11.1, Ndr Ser/Thr kinase-like protein, NDR1, NDR1 protein kinase, NDRnuclear Dbf2-related 1, Nuclear Dbf2-related kinase 1, serine threonine protein kinase, serine/threonine kinase 38, serine/threonine-protein kinase 38
Gene Symbols STK38
Host Species Rabbit
Immunogen Synthetic peptides corresponding to STK38(serine/threonine kinase 38) The peptide sequence was selected from the C terminal of STK38. Peptide sequence IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 11329
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Zebrafish: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.