STRA13 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP155505	100 μL

Catalog No. NBP155505 Supplier Novus Biologicals Supplier No. NBP155505

Description

Rabbit Polyclonal Antibody

STRA13 Polyclonal specifically detects STRA13 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: STRA13
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: A8MT69-2
• Gene Alias: BHLHE40, CENPX, CENP-X, DEC1, FAAP10, FANCM-interacting histone fold protein 2, Fanconi anemia-associated polypeptide of 10 kDa, HLHB2, MGC14480, MHF2centromere protein X, Retinoic acid-inducible gene D9 protein homolog, stimulated by retinoic acid 13, stimulated by retinoic acid 13 homolog (mouse), Stimulated by retinoic acid gene 13 protein homolog
• Gene Symbols: CENPX
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to STRA13(stimulated by retinoic acid 13 homolog (mouse)) The peptide sequence was selected from the middle region of STRA13. Peptide sequence MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVD.
• Molecular Weight of Antigen: 7 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 201254
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only