STRIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25657025UL

Catalog No. NB435471

Description

STRIP1 Polyclonal specifically detects STRIP1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: STRIP1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: FAM40A, Family With Sequence Similarity 40, Member A, FAR11 Factor Arrest 11 Homolog A, FAR11 Factor Arrest 11 Homolog A (Yeast), FAR11A, Homolog Of Yeast FAR11 Protein 1, KIAA1761, Protein FAM40A, Striatin Interacting Protein 1, Striatin-Interacting Protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 85369
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: STRIP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSIKVIRNMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG

For Research Use Only