Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

STRIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $646.00

Specifications

Antigen	STRIP1
Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP256570 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP256570	100 μL	Each for $646.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB435471 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25657025UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

STRIP1 Polyclonal specifically detects STRIP1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	STRIP1
Classification	Polyclonal
Host Species	Rabbit
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	85369
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSIKVIRNMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEE
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	FAM40A, Family With Sequence Similarity 40, Member A, FAR11 Factor Arrest 11 Homolog A, FAR11 Factor Arrest 11 Homolog A (Yeast), FAR11A, Homolog Of Yeast FAR11 Protein 1, KIAA1761, Protein FAM40A, Striatin Interacting Protein 1, Striatin-Interacting Protein 1
Gene Symbols	STRIP1
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

STRIP1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents