STYXL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179814

Catalog No. NBP179814

Description

STYXL1 Polyclonal specifically detects STYXL1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: STYXL1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dual specificity phosphatase 24 (putative), Dual specificity phosphatase inhibitor MK-STYX, Dual specificity protein phosphatase 24, DUSP24, Map kinase phosphatase-like protein MK-STYX, MKSTYX, MK-STYX, serine/threonine/tyrosine interacting-like 1, serine/threonine/tyrosine-interacting-like protein 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 51657
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_057170
• Gene Symbols: STYXL1
• Immunogen: Synthetic peptide directed towards the middle region of human STYXL1The immunogen for this antibody is STYXL1. Peptide sequence FLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 84% Guinea pig: 86%; Rat: 79%.
• Target Species: Human, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG