Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

STYXL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	STYXL1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP179814 View Documents View Product Certificates	Novus Biologicals NBP179814	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

STYXL1 Polyclonal specifically detects STYXL1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	STYXL1
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Signal Transduction
Gene Alias	dual specificity phosphatase 24 (putative), Dual specificity phosphatase inhibitor MK-STYX, Dual specificity protein phosphatase 24, DUSP24, Map kinase phosphatase-like protein MK-STYX, MKSTYX, MK-STYX, serine/threonine/tyrosine interacting-like 1, serine/threonine/tyrosine-interacting-like protein 1
Gene Symbols	STYXL1
Isotype	IgG
Molecular Weight of Antigen	36 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	NP_057170
Gene ID (Entrez)	51657
Immunogen	Synthetic peptide directed towards the middle region of human STYXL1The immunogen for this antibody is STYXL1. Peptide sequence FLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKA.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

STYXL1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents