SULT1A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP231904

Catalog No. NBP231904

Description

SULT1A2 Polyclonal specifically detects SULT1A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SULT1A2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P50226
• Gene Symbols: SULT1A2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLL
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Aryl sulfotransferase 2, arylamine sulfotransferase, EC 2.8.2, EC 2.8.2.1, HAST4, MGC142287, MGC142289, Phenol sulfotransferase 2, phenolic-metabolizing (P) form of PST, phenol-preferring phenol sulfotransferase2, Phenol-sulfating phenol sulfotransferase 2, P-PST 2, ST1A2, STP2P-PST, sulfotransferase 1A2, sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2, thermostable phenol sulfotransferase, TSPST2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6799
• Target Species: Human
• Isotype: IgG

For Research Use Only