Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SUMO2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24675825UL
Description
SUMO2 Polyclonal antibody specifically detects SUMO2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
SUMO2 | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
A8MU27 | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
HSMT3, MGC117191, sentrin 2, Sentrin-2, small ubiquitin-like modifier 2, small ubiquitin-related modifier 2, SMT3 (suppressor of mif two 3, yeast) homolog 2, SMT3 homolog 2, SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae), SMT3 suppressor of mif two 3 homolog 2 (yeast), SMT3A, SMT3B, SMT3H2, SUMO-2, SUMO3, SUMO-3, Ubiquitin-like protein SMT3A, ubiquitin-like protein SMT3B | |
This antibody was developed against Recombinant Protein corresponding to amino acids: HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC | |
25 μL | |
Epigenetics | |
6613 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction