SUMO2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB396335	Novus Biologicals NBP24675825UL	25 μL

Description

SUMO2 Polyclonal antibody specifically detects SUMO2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SUMO2
• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Epigenetics
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene Alias: HSMT3, MGC117191, sentrin 2, Sentrin-2, small ubiquitin-like modifier 2, small ubiquitin-related modifier 2, SMT3 (suppressor of mif two 3, yeast) homolog 2, SMT3 homolog 2, SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae), SMT3 suppressor of mif two 3 homolog 2 (yeast), SMT3A, SMT3B, SMT3H2, SUMO-2, SUMO3, SUMO-3, Ubiquitin-like protein SMT3A, ubiquitin-like protein SMT3B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: A8MU27
• Gene ID (Entrez): 6613
• Isotype: IgG
• Purification Method: Immunogen affinity purified