Suppressor of Ty 4 homolog 1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310372100UL

Catalog No. NB125645

Description

Suppressor of Ty 4 homolog 1 Polyclonal specifically detects Suppressor of Ty 4 homolog 1 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: Suppressor of Ty 4 homolog 1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: DRB sensitivity-inducing factor 14 kDa subunit, DRB sensitivity-inducing factor small subunit, DSIF p14, DSIF small subunit, SPT4, SPT4HhSPT4, suppressor of Ty (S.cerevisiae) 4 homolog 1, suppressor of Ty 4 homolog 1 (S. cerevisiae), SUPT4H, transcription elongation factor SPT4
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Suppressor of Ty 4 homolog 1 (NP_001099298). Peptide sequence FDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGV
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Rat
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6827
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.