Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Suppressor of Ty 4 homolog 1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Suppressor of Ty 4 homolog 1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Suppressor of Ty 4 homolog 1 Polyclonal specifically detects Suppressor of Ty 4 homolog 1 in Rat samples. It is validated for Western Blot.Specifications
| Suppressor of Ty 4 homolog 1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Rat | |
| DRB sensitivity-inducing factor 14 kDa subunit, DRB sensitivity-inducing factor small subunit, DSIF p14, DSIF small subunit, SPT4, SPT4HhSPT4, suppressor of Ty (S.cerevisiae) 4 homolog 1, suppressor of Ty 4 homolog 1 (S. cerevisiae), SUPT4H, transcription elongation factor SPT4 | |
| The immunogen is a synthetic peptide directed towards the middle region of Rat Suppressor of Ty 4 homolog 1 (NP_001099298). Peptide sequence FDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGV | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 6827 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title