Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SUPT16H Antibody, Novus Biologicals™
SDP

Catalog No. NBP238607 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238607 0.1 mL
NB396745 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238607 Supplier Novus Biologicals Supplier No. NBP238607
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SUPT16H Polyclonal specifically detects SUPT16H in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen SUPT16H
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9Y5B9
Gene Alias CDC68, Chromatin-specific transcription elongation factor 140 kDa subunit, facilitates chromatin remodeling 140 kDa subunit, Facilitates chromatin transcription complex subunit SPT16, FACT 140 kDa subunit, FACT complex subunit SPT16, FACT140, FACTp140, FACTP140FACT, FLJ10857, FLJ14010, FLJ34357, hSPT16, SPT16/CDC68, suppressor of Ty (S.cerevisiae) 16 homolog, suppressor of Ty 16 homolog (S. cerevisiae)
Gene Symbols SUPT16H
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSY
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11198
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.