SUV3L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23404725UL

Catalog No. NB397270

Description

SUV3L1 Polyclonal specifically detects SUV3L1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SUV3L1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q8IYB8
• Gene Symbols: SUPV3L1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKEGEVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ATP-dependent RNA helicase SUPV3L1, mitochondrial, EC 3.6.1, EC 3.6.4.13, suppressor of var1 (S.cerevisiae) 3-like 1, Suppressor of var1 3-like protein 1, suppressor of var1, 3-like 1 (S. cerevisiae), SUV3-like protein 1, SUV3suppressor of var1, 3-like 1(SUV3)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6832
• Target Species: Human
• Isotype: IgG

For Research Use Only