SUV420H2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP230524

Catalog No. NBP230524

Description

SUV420H2 Polyclonal specifically detects SUV420H2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SUV420H2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q86Y97
• Gene Symbols: KMT5C
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EGFFGEKNEHCECHTCERKGEGAFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSG
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% GlycerolS with 0.02% Sodium Azide
• Gene Alias: EC 2.1.1.43, FLJ98627, histone-lysine N-methyltransferase SUV420H2, KMT5Csuv4-20h2, Lysine N-methyltransferase 5C, MGC2705, Su(var)4-20 homolog 2, Suppressor of variegation 4-20 homolog 2, suppressor of variegation 4-20 homolog 2 (Drosophila), Suv4-20h2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84787
• Target Species: Human
• Isotype: IgG

For Research Use Only