SUV420H2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB437552	Novus Biologicals NBP23052425UL	25ul
NBP230524	Novus Biologicals NBP230524	0.1 mL

Description

SUV420H2 Polyclonal specifically detects SUV420H2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SUV420H2
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% GlycerolS with 0.02% Sodium Azide
• Gene Alias: EC 2.1.1.43, FLJ98627, histone-lysine N-methyltransferase SUV420H2, KMT5Csuv4-20h2, Lysine N-methyltransferase 5C, MGC2705, Su(var)4-20 homolog 2, Suppressor of variegation 4-20 homolog 2, suppressor of variegation 4-20 homolog 2 (Drosophila), Suv4-20h2
• Gene Symbols: KMT5C
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q86Y97
• Gene ID (Entrez): 84787
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EGFFGEKNEHCECHTCERKGEGAFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only