Synaptic glycoprotein SC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160088

Catalog No. NBP160088

Description

Synaptic glycoprotein SC2 Polyclonal specifically detects Synaptic glycoprotein SC2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Synaptic glycoprotein SC2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 1.3.1, EC 1.3.1.38, glycoprotein, synaptic 2, GPSN2, Synaptic glycoprotein SC2, TERSC2, trans-2,3-enoyl-CoA reductase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9524
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NZ01
• Gene Symbols: TECR
• Immunogen: Synthetic peptides corresponding to GPSN2(glycoprotein, synaptic 2) The peptide sequence was selected from the middle region of GPSN2. Peptide sequence PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG