Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Synaptic glycoprotein SC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16008820UL
Description
Synaptic glycoprotein SC2 Polyclonal specifically detects Synaptic glycoprotein SC2 in Human samples. It is validated for Western Blot.Specifications
Synaptic glycoprotein SC2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9NZ01 | |
TECR | |
Synthetic peptides corresponding to GPSN2(glycoprotein, synaptic 2) The peptide sequence was selected from the middle region of GPSN2. Peptide sequence PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 1.3.1, EC 1.3.1.38, glycoprotein, synaptic 2, GPSN2, Synaptic glycoprotein SC2, TERSC2, trans-2,3-enoyl-CoA reductase | |
Rabbit | |
Affinity Purified | |
RUO | |
9524 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction