Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Synaptic glycoprotein SC2 Antibody, Novus Biologicals™

Synaptic glycoprotein SC2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16008820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16008820 20 μL
NBP160088 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16008820 Supplier Novus Biologicals Supplier No. NBP16008820UL

Description

Rabbit Polyclonal Antibody

Synaptic glycoprotein SC2 Polyclonal specifically detects Synaptic glycoprotein SC2 in Human samples. It is validated for Western Blot.

Specifications

Antigen Synaptic glycoprotein SC2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NZ01
Gene Alias EC 1.3.1, EC 1.3.1.38, glycoprotein, synaptic 2, GPSN2, Synaptic glycoprotein SC2, TERSC2, trans-2,3-enoyl-CoA reductase
Gene Symbols TECR
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GPSN2(glycoprotein, synaptic 2) The peptide sequence was selected from the middle region of GPSN2. Peptide sequence PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9524
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.