Synaptojanin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157368

Catalog No. NBP157368

Description

Synaptojanin 1 Polyclonal specifically detects Synaptojanin 1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Synaptojanin 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.3, EC 3.1.3.36, KIAA0910, polyphosphoinositide phosphatase, 10synaptojanin-1, Synaptic inositol-14,5-trisphosphate 5-phosphatase 1, synaptojanin 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Pig: 100%; Equine: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Canine: 85%; Guinea pig: 85%.
• Target Species: Human, Mouse, Rat, Pig, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O43426
• Gene Symbols: SYNJ1
• Immunogen: Synthetic peptides corresponding to SYNJ1(synaptojanin 1) The peptide sequence was selected from the middle region of SYNJ1. Peptide sequence PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP.
• Quantity: 100 μL
• Research Discipline: Cellular Markers, Neuronal Cell Markers, Neuroscience, Neurotransmission
• Gene ID (Entrez): 8867
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.