Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Synaptojanin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Synaptojanin 1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Synaptojanin 1 Polyclonal specifically detects Synaptojanin 1 in Human samples. It is validated for Western Blot.Specifications
Synaptojanin 1 | |
Polyclonal | |
Rabbit | |
Cellular Markers, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
EC 3.1.3, EC 3.1.3.36, KIAA0910, polyphosphoinositide phosphatase, 10synaptojanin-1, Synaptic inositol-14,5-trisphosphate 5-phosphatase 1, synaptojanin 1 | |
SYNJ1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
O43426 | |
8867 | |
Synthetic peptides corresponding to SYNJ1(synaptojanin 1) The peptide sequence was selected from the middle region of SYNJ1. Peptide sequence PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title